SCOPe 2.06: Domain d4z9ha_: 4z9h A:

Lineage for d4z9ha_ (4z9h A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.2: Aspartate receptor, ligand-binding domain [47170] (2 families)
   automatically mapped to Pfam PF02203

5. Family a.24.2.0: automated matches [254222] (1 protein)
   not a true family

6. Protein automated matches [254505] (3 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [319821] (3 PDB entries)

8. Domain d4z9ha_: 4z9h A: [319845]
   automated match to d2d4ub_
   complexed with asp

Details for d4z9ha_

PDB Entry: 4z9h, 1.45 Å

PDB Description: asp-tar from e. coli

PDB Compounds: (A:) methyl-accepting chemotaxis protein II

SCOPe Domain Sequences for d4z9ha_:

Sequence; same for both SEQRES and ATOM records:

>d4z9ha_ a.24.2.0 (A:) automated matches {Escherichia coli [TaxId: 83333]}
slffsslhhsqksfvvsnqlreqqgeltstwdlmlqtrinlsrsavrmmmdssnqqsnak
velldsarktlaqaathykkfksmaplpemvatsrnidekyknyytaltelidyldygnt
gayfaqptqgmqnamgeafaqyalsseklyrdivtdnaddyrfaq

Timeline for d4z9ha_:

• d4z9ha_ is new in SCOPe 2.06-stable
  
• d4z9ha_ appears in SCOPe 2.07
  
• d4z9ha_ appears in the current release, SCOPe 2.08