SCOPe 2.06: Domain d5k79a_: 5k79 A:

Lineage for d5k79a_ (5k79 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.89: Cyanovirin-N [51321] (1 superfamily)
   complex fold

4. Superfamily b.89.1: Cyanovirin-N [51322] (2 families)
   duplication: tandem repeat of two homologous motifs made three stranded beta-sheet and beta-hairpins
   automatically mapped to Pfam PF08881

5. Family b.89.1.0: automated matches [254247] (1 protein)
   not a true family

6. Protein automated matches [254566] (5 species)
   not a true protein

7. Species Cyanothece sp. [TaxId:65393] [319783] (1 PDB entry)

8. Domain d5k79a_: 5k79 A: [319844]
   automated match to d3ezma_
   complexed with edo, peg

Details for d5k79a_

PDB Entry: 5k79, 1.6 Å

PDB Description: structure and anti-hiv activity of cyt-cvnh, a new cyanovirin-n homolog

PDB Compounds: (A:) Cyanovirin-N domain protein

SCOPe Domain Sequences for d5k79a_:

Sequence; same for both SEQRES and ATOM records:

>d5k79a_ b.89.1.0 (A:) automated matches {Cyanothece sp. [TaxId: 65393]}
tgqfsktceditldgstlsafcqkadgytlnetsinldeeignldgtlswgdhnfsltcd
siglaqslftrtyvlaaecerrdgytyipteieldehianidgtltye

Timeline for d5k79a_:

• d5k79a_ is new in SCOPe 2.06-stable
  
• d5k79a_ appears in SCOPe 2.07
  
• d5k79a_ appears in the current release, SCOPe 2.08