Lineage for d5k79a_ (5k79 A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2407676Fold b.89: Cyanovirin-N [51321] (1 superfamily)
    complex fold
  4. 2407677Superfamily b.89.1: Cyanovirin-N [51322] (2 families) (S)
    duplication: tandem repeat of two homologous motifs made three stranded beta-sheet and beta-hairpins
    automatically mapped to Pfam PF08881
  5. 2407734Family b.89.1.0: automated matches [254247] (1 protein)
    not a true family
  6. 2407735Protein automated matches [254566] (5 species)
    not a true protein
  7. 2407736Species Cyanothece sp. [TaxId:65393] [319783] (1 PDB entry)
  8. 2407737Domain d5k79a_: 5k79 A: [319844]
    automated match to d3ezma_
    complexed with edo, peg

Details for d5k79a_

PDB Entry: 5k79 (more details), 1.6 Å

PDB Description: structure and anti-hiv activity of cyt-cvnh, a new cyanovirin-n homolog
PDB Compounds: (A:) Cyanovirin-N domain protein

SCOPe Domain Sequences for d5k79a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k79a_ b.89.1.0 (A:) automated matches {Cyanothece sp. [TaxId: 65393]}
tgqfsktceditldgstlsafcqkadgytlnetsinldeeignldgtlswgdhnfsltcd
siglaqslftrtyvlaaecerrdgytyipteieldehianidgtltye

SCOPe Domain Coordinates for d5k79a_:

Click to download the PDB-style file with coordinates for d5k79a_.
(The format of our PDB-style files is described here.)

Timeline for d5k79a_: