Lineage for d5j8fa1 (5j8f A:177-447)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. Protein automated matches [190038] (49 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [225745] (65 PDB entries)
  8. Domain d5j8fa1: 5j8f A:177-447 [319841]
    Other proteins in same PDB: d5j8fa2
    automated match to d3qaha_
    complexed with cl, zn

Details for d5j8fa1

PDB Entry: 5j8f (more details), 2.6 Å

PDB Description: human mof k274p crystal structure
PDB Compounds: (A:) Histone acetyltransferase KAT8

SCOPe Domain Sequences for d5j8fa1:

Sequence, based on SEQRES records: (download)

>d5j8fa1 d.108.1.0 (A:177-447) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kyvdkihignyeidawyfspfpedygkqpklwlceyclkymkyeksyrfhlgqcqwrqpp
gkeiyrksnisvyevdgkdhkiycqnlcllaklfldhptlyfdvepfvfyiltevdrqga
hivgyfskekespdgnnvaciltlppyqrrgygkfliafsyelsklestvgspekplsdl
gklsyrsywswvlleilrdfrgtlsikdlsqmtsitqndiistlqslnmvkywkgqhvic
vtpklveehlksaqykkppitvdsvclkwap

Sequence, based on observed residues (ATOM records): (download)

>d5j8fa1 d.108.1.0 (A:177-447) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kyvdkihignyeidawyfspfpedygkqpklwlceyclkymkyeksyrfhlgqcqwrqpp
gkeiyrksnisvyevdgkdhkiycqnlcllaklfldhdvepfvfyiltevdrqgahivgy
fskekespdgnnvaciltlppyqrrgygkfliafsyelsklestvgspekplsdlgklsy
rsywswvlleilrdftlsikdlsqmtsitqndiistlqslnmvkywkgqhvicvtpklve
ehlksaqykkppitvdsvclkwap

SCOPe Domain Coordinates for d5j8fa1 are not available.

Timeline for d5j8fa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5j8fa2