SCOPe 2.08: Domain d4z9ka_: 4z9k A:

Lineage for d4z9ka_ (4z9k A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
   contains mixed beta-sheet

4. Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families)

5. Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)

6. Protein automated matches [190420] (9 species)
   not a true protein

7. Species Castor bean (Ricinus communis) [TaxId:3988] [188830] (15 PDB entries)

8. Domain d4z9ka_: 4z9k A: [319830]
   Other proteins in same PDB: d4z9kb_
   automated match to d3px8x_
   complexed with cl, edo, zn

Details for d4z9ka_

PDB Entry: 4z9k, 1.5 Å

PDB Description: ricin a chain bound to camelid nanobody (vhh2)(f5)

PDB Compounds: (A:) ricin

SCOPe Domain Sequences for d4z9ka_:

Sequence; same for both SEQRES and ATOM records:

>d4z9ka_ d.165.1.1 (A:) automated matches {Castor bean (Ricinus communis) [TaxId: 3988]}
kqypiinfttagatvqsytnfiravrgrlttgadvrheipvlpnrvglpinqrfilvels
nhaelsvtlaldvtnayvvgyragnsayffhpdnqedaeaithlftdvqnrytfafggny
drleqlagnlrenielgngpleeaisalyyystggtqlptlarsfiiciqmiseaarfqy
iegemrtrirynrrsapdpsvitlenswgrlstaiqesnqgafaspiqlqrrngskfsvy
dvsilipiialmvyrcap

Timeline for d4z9ka_:

• d4z9ka_ first appeared in SCOPe 2.06
  
• d4z9ka_ appears in SCOPe 2.07