SCOP 1.65: Domain d421p__: 421p -

Lineage for d421p__ (421p -)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (21 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (35 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein cH-p21 Ras protein [52593] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52594] (42 PDB entries)

8. Domain d421p__: 421p - [31983]
   complexed with gtn, mg; mutant

Details for d421p__

PDB Entry: 421p, 2.2 Å

PDB Description: three-dimensional structures of h-ras p21 mutants: molecular basis for their inability to function as signal switch molecules

SCOP Domain Sequences for d421p__:

Sequence; same for both SEQRES and ATOM records:

>d421p__ c.37.1.8 (-) cH-p21 Ras protein {Human (Homo sapiens)}
mteyklvvvgargvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh

Timeline for d421p__:

• d421p__ first appeared (with stable ids) in SCOP 1.55
  
• d421p__ appears in SCOP 1.63
  
• d421p__ appears in SCOP 1.67
  
• d421p__ appears in the current release, SCOPe 2.08, called d421pa_