Lineage for d4s0ob_ (4s0o B:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2626588Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 2626682Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 2626683Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
    Pfam PF00452
  6. 2626864Protein Proapoptotic molecule Bax [56862] (3 species)
  7. 2626865Species Human (Homo sapiens) [TaxId:9606] [56863] (7 PDB entries)
  8. 2626868Domain d4s0ob_: 4s0o B: [319829]
    automated match to d2k7wa_

Details for d4s0ob_

PDB Entry: 4s0o (more details), 1.9 Å

PDB Description: crystal structure of the autoinhibited dimer of pro-apoptotic bax (i)
PDB Compounds: (B:) Apoptosis regulator BAX

SCOPe Domain Sequences for d4s0ob_:

Sequence, based on SEQRES records: (download)

>d4s0ob_ f.1.4.1 (B:) Proapoptotic molecule Bax {Human (Homo sapiens) [TaxId: 9606]}
ptsseqimktgalllqgfiqdragrmggeapelaldpvpqdastkklseclkrigdelds
nmelqrmiaavdtdsprevffrvaadmfsdgnfnwgrvvalfyfasklvlkalctkvpel
irtimgwtldflrerllgwiqdqggwdgllsyfgtgtwqtvtifvagvltasltiwkkmg

Sequence, based on observed residues (ATOM records): (download)

>d4s0ob_ f.1.4.1 (B:) Proapoptotic molecule Bax {Human (Homo sapiens) [TaxId: 9606]}
ptsseqimktgalllqgfiqdrageapelaldpvpqdastkklseclkrigdeldsnmel
qrmiaavdtdsprevffrvaadmfsdgnfnwgrvvalfyfasklvlkalctkvpelirti
mgwtldflrerllgwiqdqggwdgllsyfgtgtwqtvtifvagvltasltiwkkmg

SCOPe Domain Coordinates for d4s0ob_:

Click to download the PDB-style file with coordinates for d4s0ob_.
(The format of our PDB-style files is described here.)

Timeline for d4s0ob_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4s0oa_