SCOPe 2.08: Domain d4ympa_: 4ymp A:

Lineage for d4ympa_ (4ymp A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.28: NEAT domain-like [158911] (2 families)

5. Family b.1.28.0: automated matches [195425] (1 protein)
   not a true family

6. Protein automated matches [195426] (7 species)
   not a true protein

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [195437] (5 PDB entries)

8. Domain d4ympa_: 4ymp A: [319828]
   automated match to d4h8qa_
   complexed with hem

Details for d4ympa_

PDB Entry: 4ymp, 3.15 Å

PDB Description: crystal structure of the bacillus anthracis hal neat domain in complex with heme

PDB Compounds: (A:) Internalin

SCOPe Domain Sequences for d4ympa_:

Sequence, based on SEQRES records:

>d4ympa_ b.1.28.0 (A:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
vfdavikaykdnsdeesyatvyikdpkltiengkriitatlkdsdffdylkvedskepgv
fhdvkvlsedkrkhgtkviqfevgelgkrynmqmhiliptlgydkefkiqfevnmrtfv

Sequence, based on observed residues (ATOM records):

>d4ympa_ b.1.28.0 (A:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
vfdavikaykdnsdeesyatvyikdpkltiengkriitatlkdsdffdylkvefhdvkvl
sedkrkhgtkviqfevgelgkrynmqmhiliptlgydkefkiqfevnmrtfv

Timeline for d4ympa_:

• d4ympa_ first appeared in SCOPe 2.06
  
• d4ympa_ appears in SCOPe 2.07