Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.1: Enolase [51605] (2 proteins) automatically mapped to Pfam PF00113 |
Protein Enolase [51606] (10 species) Fold of this protein slightly differs from common fold in topology |
Species Human (Homo sapiens), gamma isoform [TaxId:9606] [110371] (15 PDB entries) Uniprot P09104 |
Domain d4zcwa2: 4zcw A:141-434 [319824] Other proteins in same PDB: d4zcwa1, d4zcwb1 automated match to d2akza1 complexed with 4ng, mg |
PDB Entry: 4zcw (more details), 1.99 Å
SCOPe Domain Sequences for d4zcwa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zcwa2 c.1.11.1 (A:141-434) Enolase {Human (Homo sapiens), gamma isoform [TaxId: 9606]} sdlilpvpafnvinggshagnklamqefmilpvgaesfrdamrlgaevyhtlkgvikdky gkdatnvgdeggfapnilensealelvkeaidkagytekivigmdvaasefyrdgkydld fksptdpsryitgdqlgalyqdfvrdypvvsiedpfdqddwaawskftanvgiqivgddl tvtnpkrieraveekacnclllkvnqigsvteaiqacklaqengwgvmvshrsgetedtf iadlvvglctgqiktgapcrserlakynqlmrieeelgdearfaghnfrnpsvl
Timeline for d4zcwa2: