Lineage for d4zcwa1 (4zcw A:2-140)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2515158Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2515159Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2515160Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 2515211Protein Enolase [54828] (10 species)
  7. 2515255Species Human (Homo sapiens), gamma isoform [TaxId:9606] [110936] (15 PDB entries)
    Uniprot P09104
  8. 2515272Domain d4zcwa1: 4zcw A:2-140 [319823]
    Other proteins in same PDB: d4zcwa2, d4zcwb2
    automated match to d2akza2
    complexed with 4ng, mg

Details for d4zcwa1

PDB Entry: 4zcw (more details), 1.99 Å

PDB Description: structure of human enolase 2 in complex with sf2312
PDB Compounds: (A:) Gamma-enolase

SCOPe Domain Sequences for d4zcwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zcwa1 d.54.1.1 (A:2-140) Enolase {Human (Homo sapiens), gamma isoform [TaxId: 9606]}
siekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgkg
vlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavcka
gaaerelplyrhiaqlagn

SCOPe Domain Coordinates for d4zcwa1:

Click to download the PDB-style file with coordinates for d4zcwa1.
(The format of our PDB-style files is described here.)

Timeline for d4zcwa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4zcwa2