Lineage for d4z9hb_ (4z9h B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2699469Superfamily a.24.2: Aspartate receptor, ligand-binding domain [47170] (2 families) (S)
    automatically mapped to Pfam PF02203
  5. 2699485Family a.24.2.0: automated matches [254222] (1 protein)
    not a true family
  6. 2699486Protein automated matches [254505] (3 species)
    not a true protein
  7. 2699493Species Escherichia coli [TaxId:83333] [319821] (3 PDB entries)
  8. 2699495Domain d4z9hb_: 4z9h B: [319822]
    automated match to d2d4ub_
    complexed with asp

Details for d4z9hb_

PDB Entry: 4z9h (more details), 1.45 Å

PDB Description: asp-tar from e. coli
PDB Compounds: (B:) methyl-accepting chemotaxis protein II

SCOPe Domain Sequences for d4z9hb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4z9hb_ a.24.2.0 (B:) automated matches {Escherichia coli [TaxId: 83333]}
lhhsqksfvvsnqlreqqgeltstwdlmlqtrinlsrsavrmmmdssnqqsnakvellds
arktlaqaathykkfksmaplpemvatsrnidekyknyytaltelidyldygntgayfaq
ptqgmqnamgeafaqyalsseklyrdivtdnaddyrfa

SCOPe Domain Coordinates for d4z9hb_:

Click to download the PDB-style file with coordinates for d4z9hb_.
(The format of our PDB-style files is described here.)

Timeline for d4z9hb_: