Lineage for d2nbwb_ (2nbw B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2933104Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2933105Protein automated matches [190233] (31 species)
    not a true protein
  7. 2933120Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [193300] (9 PDB entries)
  8. 2933132Domain d2nbwb_: 2nbw B: [319818]
    automated match to d5hpte_

Details for d2nbwb_

PDB Entry: 2nbw (more details)

PDB Description: solution structure of the rpn1 t1 site with the rad23 ubl domain
PDB Compounds: (B:) UV excision repair protein RAD23

SCOPe Domain Sequences for d2nbwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nbwb_ d.15.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
mvsltfknfkkekvpldlepsntiletktklaqsisceesqikliysgkvlqdsktvsec
glkdgdqvvfmvsqkkst

SCOPe Domain Coordinates for d2nbwb_:

Click to download the PDB-style file with coordinates for d2nbwb_.
(The format of our PDB-style files is described here.)

Timeline for d2nbwb_: