Lineage for d5lcka_ (5lck A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2586062Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2586063Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2586210Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2588425Protein MAP kinase Erk2 [56134] (2 species)
    CMGC group; ERK/MAPK subfamily; serine/threonine kinase
  7. 2588426Species Human (Homo sapiens) [TaxId:9606] [56135] (69 PDB entries)
  8. 2588462Domain d5lcka_: 5lck A: [319815]
    automated match to d3sa0a_
    complexed with 6tt, so4

Details for d5lcka_

PDB Entry: 5lck (more details), 1.89 Å

PDB Description: a clickable covalent erk 1/2 inhibitor
PDB Compounds: (A:) Mitogen-activated protein kinase 1

SCOPe Domain Sequences for d5lcka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lcka_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]}
pemvrgqvfdvgprytnlsyigegaygmvcsaydnvnkvrvaikkispfehqtycqrtlr
eikillrfrheniigindiiraptieqmkdvyivqdlmetdlykllktqhlsndhicyfl
yqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadpdhdhtgflteyvat
rwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgilgspsqe
dlnciinlkarnyllslphknkvpwnrlfpnadskaldlldkmltfnphkrieveqalah
pyleqyydpsdepiaeapfkfdmelddlpkeklkelifeetarfqpg

SCOPe Domain Coordinates for d5lcka_:

Click to download the PDB-style file with coordinates for d5lcka_.
(The format of our PDB-style files is described here.)

Timeline for d5lcka_: