Lineage for d4s0oa_ (4s0o A:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2250850Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 2250926Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 2250927Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
    Pfam PF00452
  6. 2251050Protein Proapoptotic molecule Bax [56862] (1 species)
  7. 2251051Species Human (Homo sapiens) [TaxId:9606] [56863] (3 PDB entries)
  8. 2251052Domain d4s0oa_: 4s0o A: [319814]
    automated match to d2k7wa_

Details for d4s0oa_

PDB Entry: 4s0o (more details), 1.9 Å

PDB Description: crystal structure of the autoinhibited dimer of pro-apoptotic bax (i)
PDB Compounds: (A:) Apoptosis regulator BAX

SCOPe Domain Sequences for d4s0oa_:

Sequence, based on SEQRES records: (download)

>d4s0oa_ f.1.4.1 (A:) Proapoptotic molecule Bax {Human (Homo sapiens) [TaxId: 9606]}
ptsseqimktgalllqgfiqdragrmggeapelaldpvpqdastkklseclkrigdelds
nmelqrmiaavdtdsprevffrvaadmfsdgnfnwgrvvalfyfasklvlkalctkvpel
irtimgwtldflrerllgwiqdqggwdgllsyfgtgtwqtvtifvagvltasltiwkkmg

Sequence, based on observed residues (ATOM records): (download)

>d4s0oa_ f.1.4.1 (A:) Proapoptotic molecule Bax {Human (Homo sapiens) [TaxId: 9606]}
ptsseqimktgalllqgfiqdraeapelaldpvpqdastkklseclkrigdeldsnmelq
rmiaavdtdsprevffrvaadmfsdgnfnwgrvvalfyfasklvlkalctkvpelirtim
gwtldflrerllgwiqdqggwdgllsyfgtgtwqtvtifvagvltasltiwkkmg

SCOPe Domain Coordinates for d4s0oa_:

Click to download the PDB-style file with coordinates for d4s0oa_.
(The format of our PDB-style files is described here.)

Timeline for d4s0oa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4s0ob_