SCOPe 2.08: Domain d5kh2c_: 5kh2 C:

Lineage for d5kh2c_ (5kh2 C:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156

4. Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (2 families)
   the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinase

5. Family c.101.1.0: automated matches [191361] (1 protein)
   not a true family

6. Protein automated matches [190431] (13 species)
   not a true protein

7. Species Streptococcus pneumoniae [TaxId:170187] [319781] (2 PDB entries)

8. Domain d5kh2c_: 5kh2 C: [319811]
   automated match to d4u82a_

Details for d5kh2c_

PDB Entry: 5kh2, 2.3 Å

PDB Description: crystal structure of steptococcus pneumoniae undecaprenyl pyrophosphate synthase (upps)

PDB Compounds: (C:) Isoprenyl transferase

SCOPe Domain Sequences for d5kh2c_:

Sequence, based on SEQRES records:

>d5kh2c_ c.101.1.0 (C:) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
qvpahigiimdgngrwakkrmqprvfghkagmealqtvtkaanklgvkvitvyafstenw
trpdqevkfimnlpvefydnyvpelhannvkiqmigetdrlpkqtfealtkaeeltknnt
glilnfalnyggraeitqalklisqdvldakinpgditeelignylftqhlpkdlrdpdl
iirtsgelrlsnflpwqgayselyftdtlwpdfdeaalqeailaynrrhr

Sequence, based on observed residues (ATOM records):

>d5kh2c_ c.101.1.0 (C:) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
qvpahigiimdgngrwakkrmqprvfghkagmealqtvtkaanklgvkvitvyafspdqe
vkfimnlpvefydnyvpelhannvkiqmigetdrlpkqtfealtkaeeltknntglilnf
alnyggraeitqalklisqdvldakinpgditeelignylftqhlpkdlrdpdliirtsg
elrlsnflpwqgayselyftdtlwpdfdeaalqeailaynrrr

Timeline for d5kh2c_:

• d5kh2c_ first appeared in SCOPe 2.06
  
• d5kh2c_ appears in SCOPe 2.07