Lineage for d5lhoa_ (5lho A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2333633Superfamily a.118.7: 14-3-3 protein [48445] (1 family) (S)
    automatically mapped to Pfam PF00244
  5. 2333634Family a.118.7.1: 14-3-3 protein [48446] (5 protein domains)
  6. 2333684Protein automated matches [190238] (9 species)
    not a true protein
  7. 2333753Species Lachancea thermotolerans [TaxId:381046] [319809] (1 PDB entry)
  8. 2333754Domain d5lhoa_: 5lho A: [319810]
    automated match to d4dnkb_

Details for d5lhoa_

PDB Entry: 5lho (more details), 1.95 Å

PDB Description: crystal structure of yeast 14-3-3 protein (bmh1) from lachancea thermotolerans
PDB Compounds: (A:) KLTH0G14146p

SCOPe Domain Sequences for d5lhoa_:

Sequence, based on SEQRES records: (download)

>d5lhoa_ a.118.7.1 (A:) automated matches {Lachancea thermotolerans [TaxId: 381046]}
sredsvylaklaeqaeryeemvdsmkavassgqelsveernllsvayknvigarraswri
vssieqkeeakdksehqvklirdyrskieteltkicddilsvldthlipsattgeskvfy
ykmkgdyhrylaefssgevrdkatnasleayktaseiattelppthpirlglalnfsvfy
yeiqnspdkachlakqafddaiaeldtlseesykdstlimqllrdnltlwts

Sequence, based on observed residues (ATOM records): (download)

>d5lhoa_ a.118.7.1 (A:) automated matches {Lachancea thermotolerans [TaxId: 381046]}
sredsvylaklaeqaeryeemvdsmkavassgqelsveernllsvayknvigarraswri
vssieqkeeakehqvklirdyrskieteltkicddilsvldthlipsattgeskvfyykm
kgdyhrylaefssgevrdkatnasleayktaseiattelppthpirlglalnfsvfyyei
qnspdkachlakqafddaiaeldtlseesykdstlimqllrdnltlwts

SCOPe Domain Coordinates for d5lhoa_:

Click to download the PDB-style file with coordinates for d5lhoa_.
(The format of our PDB-style files is described here.)

Timeline for d5lhoa_: