![]() | Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
![]() | Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) |
![]() | Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) ![]() |
![]() | Family c.37.1.8: G proteins [52592] (20 proteins) |
![]() | Protein cH-p21 Ras protein [52593] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [52594] (33 PDB entries) |
PDB Entry: 6q21 (more details), 1.95 Å
SCOP Domain Sequences for d6q21c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6q21c_ c.37.1.8 (C:) cH-p21 Ras protein {Human (Homo sapiens)} mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqhklrkl
Timeline for d6q21c_: