Lineage for d5ikoa_ (5iko A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2483347Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2483348Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2483412Family c.87.1.4: Oligosaccharide phosphorylase [53766] (3 proteins)
    automatically mapped to Pfam PF00343
  6. 2483557Protein automated matches [190111] (3 species)
    not a true protein
  7. 2483567Species Human (Homo sapiens) [TaxId:9606] [186954] (4 PDB entries)
  8. 2483573Domain d5ikoa_: 5iko A: [319799]
    automated match to d2qlla_
    complexed with p6g, plp, po4

Details for d5ikoa_

PDB Entry: 5iko (more details), 2.5 Å

PDB Description: crystal structure of human brain glycogen phosphorylase
PDB Compounds: (A:) Glycogen phosphorylase, brain form

SCOPe Domain Sequences for d5ikoa_:

Sequence, based on SEQRES records: (download)

>d5ikoa_ c.87.1.4 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lgdvaevrksfnrhlhftlvkdrnvatprdyffalahtvrdhlvgrwirtqqhyyerdpk
riyylslefymgrtlqntmvnlglqnacdeaiyqlgldleeleeieedaglgngglgrla
acfldsmatlglaaygygiryefgifnqkivngwqveeaddwlrygnpwekarpeymlpv
hfygrvehtpdgvkwldtqvvlampydtpvpgyknntvntmrlwsakapndfklqdfnvg
dyieavldrnlaenisrvlypndnffegkelrlkqeyfvvaatlqdiirrfksskfgcrd
pvrtcfetfpdkvaiqlndthpalsipelmrilvdvekvdwdkaweitkktcaytnhtvl
pealerwpvsmfekllprhleiiyainqrhldhvaalfpgdvdrlrrmsvieegdckrin
mahlcvigshavngvarihseivkqsvfkdfyelepekfqnktngitprrwlllcnpgla
dtivekigeefltdlsqlkkllplvsdevfirdvakvkqenklkfsaflekeykvkinps
smfdvhvkriheykrqllnclhvvtlynrikrdpakafvprtvmiggkaapgyhmaklii
klvtsigdvvnhdpvvgdrlkviflenyrvslaekvipaadlsqqistagteasgtgnmk
fmlngaltigtmdganvemaeeagaenlfifglrvedvealdrkgynareyydhlpelkq
avdqissgffspkepdcfkdivnmlmhhdrfkvfadyeaymqcqaqvdqlyrnpkewtkk
virniacsgkfssdrtiteyareiwgvepsdlqipppni

Sequence, based on observed residues (ATOM records): (download)

>d5ikoa_ c.87.1.4 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lgdvaevrksfnrhlhftlvkdrnvatprdyffalahtvrdhlvgrwirtqqhyyerdpk
riyylslefymgrtlqntmvnlglqnacdeaiyqlgldleeleeieedaglgngglgrla
acfldsmatlglaaygygiryefgifnqkivngwqveeaddwlrygnpwekarpeymlpv
hfygrvehtpdgvkwldtqvvlampydtpvpgyknntvntmrlwsakapnddfnvgdyie
avldrnlaenisrvlypndfegkelrlkqeyfvvaatlqdiirrfksskfgtcfetfpdk
vaiqlndthpalsipelmrilvdvekvdwdkaweitkktcaytnhtvlpealerwpvsmf
ekllprhleiiyainqrhldhvaalfpgdvdrlrrmsvieegdckrinmahlcvigshav
ngvarihseivkqsvfkdfyelepekfqnktngitprrwlllcnpgladtivekigeefl
tdlsqlkkllplvsdevfirdvakvkqenklkfsaflekeykvkinpssmfdvhvkrihe
ykrqllnclhvvtlynrikrdpakafvprtvmiggkaapgyhmakliiklvtsigdvvnh
dpvvgdrlkviflenyrvslaekvipaadlsqqistagteasgtgnmkfmlngaltigtm
dganvemaeeagaenlfifglrvedvealdrkgynareyydhlpelkqavdqissgffsp
kepdcfkdivnmlmhhdrfkvfadyeaymqcqaqvdqlyrnpkewtkkvirniacsgkfs
sdrtiteyareiwgvepsdlqipppni

SCOPe Domain Coordinates for d5ikoa_:

Click to download the PDB-style file with coordinates for d5ikoa_.
(The format of our PDB-style files is described here.)

Timeline for d5ikoa_: