SCOPe 2.07: Domain d5krea_: 5kre A:

Lineage for d5krea_ (5kre A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (108 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188340] (89 PDB entries)

8. Domain d5krea_: 5kre A: [319798]
   automated match to d3u0va_
   complexed with 6wg, no3

Details for d5krea_

PDB Entry: 5kre, 2 Å

PDB Description: covalent inhibitor of lyplal1

PDB Compounds: (A:) Lysophospholipase-like protein 1

SCOPe Domain Sequences for d5krea_:

Sequence; same for both SEQRES and ATOM records:

>d5krea_ c.69.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vlqrcivspagrhsasliflhgsgdsgqglrmwikqvlnqdltfqhikiiyptapprsyt
pmkggisnvwfdrfkitndcpehlesidvmcqvltdlideevksgikknriliggfsmgg
cmamhlayrnhqdvagvfalssflnkasavyqalqksngvlpelfqchgtadelvlhswa
eetnsmlkslgvttkfhsfpnvyhelskteldilklwiltklpg

Timeline for d5krea_:

• d5krea_ first appeared in SCOPe 2.06