SCOPe 2.08: Domain d5k1jb_: 5k1j B:

Lineage for d5k1jb_ (5k1j B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.3: Prealbumin-like [49451] (8 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families)

5. Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)
   automatically mapped to Pfam PF00576

6. Protein automated matches [190376] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187223] (14 PDB entries)

8. Domain d5k1jb_: 5k1j B: [319791]
   automated match to d5ezpe_
   complexed with act, dms, edo, imd, re

Details for d5k1jb_

PDB Entry: 5k1j, 1.69 Å

PDB Description: human ttr altered by a rhenium tris-carbonyl pyta-c8 derivative

PDB Compounds: (B:) Transthyretin

SCOPe Domain Sequences for d5k1jb_:

Sequence; same for both SEQRES and ATOM records:

>d5k1jb_ b.3.4.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp

Timeline for d5k1jb_:

• d5k1jb_ first appeared in SCOPe 2.06
  
• d5k1jb_ appears in SCOPe 2.07