SCOPe 2.07: Domain d5cmma1: 5cmm A:2-259

Lineage for d5cmma1 (5cmm A:2-259)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (158 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [193730] (34 PDB entries)

8. Domain d5cmma1: 5cmm A:2-259 [319789]
   Other proteins in same PDB: d5cmma2
   automated match to d3g3ja_
   complexed with sym

Details for d5cmma1

PDB Entry: 5cmm, 1.27 Å

PDB Description: crystal structure of the gluk2em lbd dimer assembly complex with 2s, 4r-4-methylglutamate

PDB Compounds: (A:) glutamate receptor ionotropic, kainate 2

SCOPe Domain Sequences for d5cmma1:

Sequence, based on SEQRES records:

>d5cmma1 c.94.1.0 (A:2-259) automated matches {Human (Homo sapiens) [TaxId: 9606]}
snrslivttileepyvlfkksdkplygndrfegycidllrelstilgftyeirlvedgky
gaqddvngqwngmvrelidhkadlavapltityvrekvidfskpfmtlgisilyrkgtpi
dsaddlakqtkieygavedgstmtffkkskistydkmwafmssrrqsvlvksseegiqrv
ltsdyallmesttiefvtqrncnltqigglidskgygvgtpmgspyrdkitiailqlqee
gklhmmkekwwrgngcpe

Sequence, based on observed residues (ATOM records):

>d5cmma1 c.94.1.0 (A:2-259) automated matches {Human (Homo sapiens) [TaxId: 9606]}
snrslivttileepyvlfkksdkplygndrfegycidllrelstilgftyeirlvedgky
gaqddvngqwngmvrelidhkadlavapltityvrekvidfskpfmtlgisilyrkgtpi
dsaddlakqtkieygavedgstmtffkkskistydkmwafmssrrqsvlvksseegiqrv
ltsdyallmesttiefvtqrncnltqigglidskgygvgtpmgspyrdkitiailqlqee
gklhmmkekwwrgcpe

Timeline for d5cmma1:

• d5cmma1 first appeared in SCOPe 2.06
  
• d5cmma1 appears in the current release, SCOPe 2.08