SCOPe 2.08: Domain d5kh5b_: 5kh5 B:

Lineage for d5kh5b_ (5kh5 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156

4. Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (2 families)
   the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinase

5. Family c.101.1.0: automated matches [191361] (1 protein)
   not a true family

6. Protein automated matches [190431] (13 species)
   not a true protein

7. Species Streptococcus pneumoniae [TaxId:170187] [319781] (2 PDB entries)

8. Domain d5kh5b_: 5kh5 B: [319782]
   automated match to d4u82a_
   complexed with 6tc

Details for d5kh5b_

PDB Entry: 5kh5, 2.63 Å

PDB Description: crystal structure of steptococcus pneumoniae undecaprenyl pyrophosphate synthase (upps) in complex with ~{n}-(3-azanyl-3- oxidanylidene-propyl)-5-(1-benzothiophen-5-yl)-1-(phenylmethyl)-~{n}- [(4-propan-2-yloxyphenyl)methyl]pyrazole-4-carboxamide

PDB Compounds: (B:) Isoprenyl transferase

SCOPe Domain Sequences for d5kh5b_:

Sequence, based on SEQRES records:

>d5kh5b_ c.101.1.0 (B:) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
tqvpahigiimdgngrwakkrmqprvfghkagmealqtvtkaanklgvkvitvyafsten
wtrpdqevkfimnlpvefydnyvpelhannvkiqmigetdrlpkqtfealtkaeeltknn
tglilnfalnyggraeitqalklisqdvldakinpgditeelignylftqhlpkdlrdpd
liirtsgelrlsnflpwqgayselyftdtlwpdfdeaalqeailaynrrh

Sequence, based on observed residues (ATOM records):

>d5kh5b_ c.101.1.0 (B:) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
tqvpahigiimdgngrwakkrmqprvfghkagmealqtvtkaanklgvkvitvyaftrpd
qevkfimnlpvefydnyvpelhannvkiqmigetdrlpkqtfealtkaeeltknntglil
nfalnyggraeitqalklisqdvldakinpgditeelignylftqhlpkdlrdpdliirt
sgelrlsnflpwqgayselyftdtlwpdfdeaalqeailaynrrh

Timeline for d5kh5b_:

• d5kh5b_ first appeared in SCOPe 2.06
  
• d5kh5b_ appears in SCOPe 2.07