Lineage for d5eztx_ (5ezt X:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2401367Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2401368Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2401369Family b.74.1.1: Carbonic anhydrase [51070] (2 protein domains)
    automatically mapped to Pfam PF00194
  6. 2401370Protein Carbonic anhydrase [51071] (10 species)
  7. 2401371Species Cow (Bos taurus), isozyme II [TaxId:9913] [51074] (5 PDB entries)
  8. 2401372Domain d5eztx_: 5ezt X: [319775]
    automated match to d1v9ea_
    complexed with zn

Details for d5eztx_

PDB Entry: 5ezt (more details), 1.54 Å

PDB Description: peracetylated bovine carbonic anhydrase ii
PDB Compounds: (X:) Carbonic anhydrase 2

SCOPe Domain Sequences for d5eztx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5eztx_ b.74.1.1 (X:) Carbonic anhydrase {Cow (Bos taurus), isozyme II [TaxId: 9913]}
hwgygkhngpehwhkdfpiangerqspvdidtkavvqdpalkplalvygeatsrrmvnng
hsfnveyddsqdkavlkdgpltgtyrlvqfhfhwgssddqgsehtvdrkkyaaelhlvhw
ntkygdfgtaaqqpdglavvgvflkvgdanpalqkvldaldsiktkgkstdfpnfdpgsl
lpnvldywtypgslttppllesvtwivlkepisvssqqmlkfrtlnfnaegepellmlan
wrpaqplknrqvrgfpk

SCOPe Domain Coordinates for d5eztx_:

Click to download the PDB-style file with coordinates for d5eztx_.
(The format of our PDB-style files is described here.)

Timeline for d5eztx_: