Lineage for d5ixeb_ (5ixe B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2093018Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2094473Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 proteins)
  6. 2094638Protein automated matches [190245] (11 species)
    not a true protein
  7. 2094662Species Sulfolobus solfataricus [TaxId:273057] [195161] (4 PDB entries)
  8. 2094668Domain d5ixeb_: 5ixe B: [319762]
    automated match to d4eama_
    complexed with 14o, cl, mpd

Details for d5ixeb_

PDB Entry: 5ixe (more details), 1.75 Å

PDB Description: 1.75a resolution structure of 5-fluoroindole bound beta-glycosidase (w33g) from sulfolobus solfataricus
PDB Compounds: (B:) beta-galactosidase

SCOPe Domain Sequences for d5ixeb_:

Sequence, based on SEQRES records: (download)

>d5ixeb_ c.1.8.4 (B:) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
mysfpnsfrfgwsqagfqsemgtpgsedpntdgykwvhdpenmaaglvsgdlpengpgyw
gnyktfhdnaqkmglkiarlnvewsrifpnplprpqnfdeskqdvteveinenelkrlde
yankdalnhyreifkdlksrglyfilnmyhwplplwlhdpirvrrgdftgpsgwlstrtv
yefarfsayiawkfddlvdeystmnepnvvgglgyvgvksgfppgylsfelsrramynii
qaharaydgiksvskkpvgiiyanssfqpltdkdmeavemaendnrwwffdaiirgeitr
gnekivrddlkgrldwigvnyytrtvvkrtekgyvslggyghgcernsvslaglptsdfg
weffpeglydvltkywnryhlymyvtengiaddadyqrpyylvshvyqvhrainsgadvr
gylhwsladnyewasgfsmrfgllkvdyntkrlywrpsalvyreiatngaitdeiehlns
vppvkplrh

Sequence, based on observed residues (ATOM records): (download)

>d5ixeb_ c.1.8.4 (B:) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
mysfpnsfrfgwsqagfqsemgtpgsedpntdgykwvhdpenmaaglvsgdlpengpgyw
gnyktfhdnaqkmglkiarlnvewsrifpnplprpqnfdeskqdvteveinenelkrlde
yankdalnhyreifkdlksrglyfilnmyhwplplwlhdpirvrrgdftgpsgwlstrtv
yefarfsayiawkfddlvdeystmnepnvvgglgyvgvksgfppgylsfelsrramynii
qaharaydgiksvskkpvgiiyanssfqpltdkdmeavemaendnrwwffdaiirgeitr
gnkivrddlkgrldwigvnyytrtvvkrtekgyvslggyghgcernsvslaglptsdfgw
effpeglydvltkywnryhlymyvtengiaddadyqrpyylvshvyqvhrainsgadvrg
ylhwsladnyewasgfsmrfgllkvdyntkrlywrpsalvyreiatngaitdeiehlnsv
ppvkplrh

SCOPe Domain Coordinates for d5ixeb_:

Click to download the PDB-style file with coordinates for d5ixeb_.
(The format of our PDB-style files is described here.)

Timeline for d5ixeb_: