SCOPe 2.08: Domain d5gjca1: 5gjc A:182-320

Lineage for d5gjca1 (5gjc A:182-320)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Zika virus (strain mr 766) [TaxId:64320] [319757] (10 PDB entries)

8. Domain d5gjca1: 5gjc A:182-320 [319758]
   automated match to d2v8oa1
   complexed with atp, mn

Details for d5gjca1

PDB Entry: 5gjc, 2.2 Å

PDB Description: zika virus ns3 helicase in complex with atp

PDB Compounds: (A:) NS3 helicase

SCOPe Domain Sequences for d5gjca1:

Sequence, based on SEQRES records:

>d5gjca1 c.37.1.0 (A:182-320) automated matches {Zika virus (strain mr 766) [TaxId: 64320]}
smlkkkqltvldlhpgagktrrvlpeivreaiktrlrtvilaptrvvaaemeealrglpv
rymttavnvthsgteivdlmchatftsrllqpirvpnynlyimdeahftdpssiaargyi
strvemgeaaaifmtatpp

Sequence, based on observed residues (ATOM records):

>d5gjca1 c.37.1.0 (A:182-320) automated matches {Zika virus (strain mr 766) [TaxId: 64320]}
smlkkkqltvldlhpgagktrrvlpeivreaiktrlrtvilaptrvvaaemeealrglpv
rymttgteivdlmchatftsrllqpirvpnynlyimdeahftdpssiaargyistrvemg
eaaaifmtatpp

Timeline for d5gjca1:

• d5gjca1 first appeared in SCOPe 2.06
  
• d5gjca1 appears in SCOPe 2.07