Lineage for d721p__ (721p -)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) 
Family c.37.1.8: G proteins [52592] (20 proteins) Protein cH-p21 Ras protein [52593] (1 species) Species Human (Homo sapiens) [TaxId:9606] [52594] (33 PDB entries) 
Domain d721p__: 721p - [31975]
Details for d721p__
PDB Entry: 721p (more details), 2 Å
PDB Description: three-dimensional structures of h-ras p21 mutants: molecular basis for their inability to function as signal switch molecules
SCOP Domain Sequences for d721p__:
Sequence; same for both SEQRES and ATOM records: (download)
>d721p__ c.37.1.8 (-) cH-p21 Ras protein {Human (Homo sapiens)}
mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
leeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh
SCOP Domain Coordinates for d721p__:
Click to download the PDB-style file with coordinates for d721p__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d721p__:
- d721p__ appears in SCOP 1.57
- d721p__ appears in the current release, SCOPe 2.08, called d721pa_
View in 3D