Lineage for d5d6rb2 (5d6r B:188-366)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2444630Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 2444631Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 2445027Family c.31.1.0: automated matches [191352] (1 protein)
    not a true family
  6. 2445028Protein automated matches [190312] (12 species)
    not a true protein
  7. 2445081Species Klebsiella pneumoniae [TaxId:573] [319717] (3 PDB entries)
  8. 2445084Domain d5d6rb2: 5d6r B:188-366 [319743]
    Other proteins in same PDB: d5d6rb1, d5d6rb3, d5d6rm1, d5d6rm3, d5d6rm4
    automated match to d1ozha1
    complexed with en0, mg, po4

Details for d5d6rb2

PDB Entry: 5d6r (more details), 2.28 Å

PDB Description: acetolactate synthase from klebsiella pneumoniae in complex with mechanism-based inhibitor
PDB Compounds: (B:) Acetolactate synthase, catabolic

SCOPe Domain Sequences for d5d6rb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5d6rb2 c.31.1.0 (B:188-366) automated matches {Klebsiella pneumoniae [TaxId: 573]}
qmgaapddaidqvakliaqaknpifllglmasqpenskalrrlletshipvtstyqaaga
vnqdnfsrfagrvglfnnqagdrllqladlvicigyspveyepamwnsgnatlvhidvlp
ayeernytpdvelvgdiagtlnklaqnidhrlvlspqaaeilrdrqhqrelldrrgaql

SCOPe Domain Coordinates for d5d6rb2:

Click to download the PDB-style file with coordinates for d5d6rb2.
(The format of our PDB-style files is described here.)

Timeline for d5d6rb2: