SCOPe 2.08: Domain d5dn2a1: 5dn2 A:275-429

Lineage for d5dn2a1 (5dn2 A:275-429)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.0: automated matches [191481] (1 protein)
   not a true family

6. Protein automated matches [190770] (51 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188939] (29 PDB entries)

8. Domain d5dn2a1: 5dn2 A:275-429 [319738]
   Other proteins in same PDB: d5dn2a2, d5dn2b2, d5dn2c2, d5dn2d2
   automated match to d1kexa_
   complexed with dio, gol

Details for d5dn2a1

PDB Entry: 5dn2, 1.95 Å

PDB Description: human nrp2 b1 domain in complex with the peptide corresponding to the c-terminus of vegf-a

PDB Compounds: (A:) Neuropilin-2

SCOPe Domain Sequences for d5dn2a1:

Sequence; same for both SEQRES and ATOM records:

>d5dn2a1 b.18.1.0 (A:275-429) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fqcnvplgmesgrianeqisasstysdgrwtpqqsrlhgddngwtpnldsnkeylqvdlr
fltmltaiatqgaisretqngyyvksyklevstngedwmvyrhgknhkvfqanndatevv
lnklhaplltrfvrirpqtwhsgialrlelfgcrv

Timeline for d5dn2a1:

• d5dn2a1 first appeared in SCOPe 2.06, called d5dn2a_
  
• d5dn2a1 was called d5dn2a_ in SCOPe 2.07