SCOPe 2.08: Domain d5f85b1: 5f85 B:48-84

Lineage for d5f85b1 (5f85 B:48-84)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein Factor IX (IXa) [57198] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57199] (33 PDB entries)

8. Domain d5f85b1: 5f85 B:48-84 [319733]
   Other proteins in same PDB: d5f85b2
   automated match to d1ccfa_
   complexed with gol, so4, udp

Details for d5f85b1

PDB Entry: 5f85, 2.15 Å

PDB Description: crystal structure of drosophila poglut1 (rumi) complexed with its substrate protein (egf repeat) and udp

PDB Compounds: (B:) coagulation factor ix

SCOPe Domain Sequences for d5f85b1:

Sequence; same for both SEQRES and ATOM records:

>d5f85b1 g.3.11.1 (B:48-84) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]}
gdqcesnpclnggsckddinsyecwcpfgfegkncel

Timeline for d5f85b1:

• d5f85b1 first appeared in SCOPe 2.06
  
• d5f85b1 appears in SCOPe 2.07