Lineage for d5cmbb_ (5cmb B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2915700Species Mnemiopsis leidyi [TaxId:27923] [278472] (6 PDB entries)
  8. 2915706Domain d5cmbb_: 5cmb B: [319732]
    automated match to d4ykib_
    complexed with gly, mg, so4; mutant

Details for d5cmbb_

PDB Entry: 5cmb (more details), 1.34 Å

PDB Description: mnemiopsis leidyi ml032222a iglur lbd r703k mutant glycine complex
PDB Compounds: (B:) ML032222a iGluR

SCOPe Domain Sequences for d5cmbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cmbb_ c.94.1.0 (B:) automated matches {Mnemiopsis leidyi [TaxId: 27923]}
gsknligrhlrlgsveeqpfmffategcegndcwsgmvndmvvklsedlgftyeyiqpdd
rkfgalnkttnewngmirdllddktdmiaidlstnsarksaidysfpfmdagikavvkge
gttlnqvlelldqdkykwgvigskhpetllkthrdsrysrlvdegvelkdlnhaietlrg
glfvfidegpvlahnlisdcdvfsvgeefqsfeyafglpkdspykslidshllkfreegf
idilwekwssgnsvc

SCOPe Domain Coordinates for d5cmbb_:

Click to download the PDB-style file with coordinates for d5cmbb_.
(The format of our PDB-style files is described here.)

Timeline for d5cmbb_: