Class a: All alpha proteins [46456] (289 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
Protein automated matches [190847] (64 species) not a true protein |
Species Streptomyces avermitilis [TaxId:227882] [260823] (3 PDB entries) |
Domain d5cjea_: 5cje A: [319726] automated match to d4b7sa_ complexed with gol, hem |
PDB Entry: 5cje (more details), 2.5 Å
SCOPe Domain Sequences for d5cjea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5cjea_ a.104.1.0 (A:) automated matches {Streptomyces avermitilis [TaxId: 227882]} vidlgeygarftedpypvyaelrergpvhwvrtpppeafegwlvvgheearaaladprls kdgtkkgltsldvelmgpyllvvdppehtrlrslvaraftmrrvealrpriqeitdglld emlprgradlvdsfayplpitvicellgvpdidrvtfralsneivaptggdaelaayerl aayldeliddkrstapaddllgdlirtraedddrlsgeelramafillvaghettvnlit ngvhtllthpdqlaalradmtlldgaveevlrfegpvetatyryaaesmeiggtaiaegd pvmigldaagrdparhpdphvfdihrapqghlafghgihyclgaplarlearvalrslle rcpdlaldgppgarppgmlirgvrrlpvrw
Timeline for d5cjea_: