SCOPe 2.05: Domain d1jaha_: 1jah A:

Lineage for d1jaha_ (1jah A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein cH-p21 Ras protein [52593] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52594] (109 PDB entries)
   Uniprot Q6P716

8. Domain d1jaha_: 1jah A: [31972]
   complexed with gcp, mg; mutant

Details for d1jaha_

PDB Entry: 1jah, 1.8 Å

PDB Description: h-ras p21 protein mutant g12p, complexed with guanosine-5'-[beta, gamma-methylene] triphosphate and magnesium

PDB Compounds: (A:) c-ha-ras

SCOPe Domain Sequences for d1jaha_:

Sequence; same for both SEQRES and ATOM records:

>d1jaha_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgapgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
agrtvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh

Timeline for d1jaha_:

• d1jaha_ first appeared (with stable ids) in SCOP 1.55, called d1jah__
  
• d1jaha_ appears in SCOPe 2.04
  
• d1jaha_ appears in SCOPe 2.06
  
• d1jaha_ appears in the current release, SCOPe 2.08