SCOPe 2.08: Domain d5co4b1: 5co4 B:1-148

Lineage for d5co4b1 (5co4 B:1-148)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.116: alpha/beta knot [75216] (1 superfamily)
   core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot

4. Superfamily c.116.1: alpha/beta knot [75217] (9 families)
   known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
   all known members have dimeric structures

5. Family c.116.1.0: automated matches [191557] (1 protein)
   not a true family

6. Protein automated matches [190961] (22 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:262724] [319700] (1 PDB entry)

8. Domain d5co4b1: 5co4 B:1-148 [319701]
   Other proteins in same PDB: d5co4a2, d5co4b2
   automated match to d1mxia_
   complexed with gol, mta

Details for d5co4b1

PDB Entry: 5co4, 1.7 Å

PDB Description: structural insights into the 2-oh methylation of c/u34 on trna

PDB Compounds: (B:) Putative tRNA (cytidine(34)-2'-O)-methyltransferase

SCOPe Domain Sequences for d5co4b1:

Sequence; same for both SEQRES and ATOM records:

>d5co4b1 c.116.1.0 (B:1-148) automated matches {Thermus thermophilus [TaxId: 262724]}
mlhlvlyqpeipqnagnvartaaalgwplhlirplgfllsspklkragldywphvdlrlh
dsfaaflealprgarvfafsargeaslyearfregdyllfgpesrglpeevlarfptlki
pmpgpvrslnlavavgvaayeayrqltg

Timeline for d5co4b1:

• d5co4b1 first appeared in SCOPe 2.06
  
• d5co4b1 appears in SCOPe 2.07