Lineage for d5ax2a_ (5ax2 A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3036286Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 3037409Superfamily g.41.17: CSL zinc finger [144217] (2 families) (S)
  5. 3037410Family g.41.17.1: CSL zinc finger [144218] (3 proteins)
    Pfam PF05207
  6. 3037418Protein automated matches [254561] (2 species)
    not a true protein
  7. 3037419Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [319697] (1 PDB entry)
  8. 3037420Domain d5ax2a_: 5ax2 A: [319698]
    automated match to d1ywsa1
    complexed with cd

Details for d5ax2a_

PDB Entry: 5ax2 (more details), 2.4 Å

PDB Description: crystal structure of s.cerevisiae kti11p
PDB Compounds: (A:) Diphthamide biosynthesis protein 3

SCOPe Domain Sequences for d5ax2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ax2a_ g.41.17.1 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
vstydeieiedmtfepenqmftypcpcgdrfqiylddmfegekvavcpscslmidvvfdk
edlaeyyeeagihppepi

SCOPe Domain Coordinates for d5ax2a_:

Click to download the PDB-style file with coordinates for d5ax2a_.
(The format of our PDB-style files is described here.)

Timeline for d5ax2a_: