| Class g: Small proteins [56992] (100 folds) |
| Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.17: CSL zinc finger [144217] (2 families) ![]() |
| Family g.41.17.1: CSL zinc finger [144218] (3 proteins) Pfam PF05207 |
| Protein automated matches [254561] (2 species) not a true protein |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [319697] (1 PDB entry) |
| Domain d5ax2a_: 5ax2 A: [319698] automated match to d1ywsa1 complexed with cd |
PDB Entry: 5ax2 (more details), 2.4 Å
SCOPe Domain Sequences for d5ax2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ax2a_ g.41.17.1 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
vstydeieiedmtfepenqmftypcpcgdrfqiylddmfegekvavcpscslmidvvfdk
edlaeyyeeagihppepi
Timeline for d5ax2a_: