Lineage for d5cmkb_ (5cmk B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2915760Species Norway rat (Rattus norvegicus) [TaxId:10116] [186759] (113 PDB entries)
  8. 2915818Domain d5cmkb_: 5cmk B: [319687]
    automated match to d3g3ja_
    complexed with cl, glu, li, ly5, so4

Details for d5cmkb_

PDB Entry: 5cmk (more details), 1.8 Å

PDB Description: crystal structure of the gluk2em lbd dimer assembly complex with glutamate and ly466195
PDB Compounds: (B:) glutamate receptor ionotropic, kainate 2

SCOPe Domain Sequences for d5cmkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cmkb_ c.94.1.0 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
snrslivttileepyvlfkksdkplygndrfegycidllrelstilgftyeirlvedgky
gaqddvngqwngmvrelidhkadlavapltityvrekvidfskpfmtlgisilyrkgtpi
dsaddlakqtkieygavedgstmtffkkskistydkmwafmssrrqsvlvksseegiqrv
ltsdyallmesttiefvtqrncnltqigglidskgygvgtpmgspyrdkitiailqlqee
gklhmmkekwwrg

SCOPe Domain Coordinates for d5cmkb_:

Click to download the PDB-style file with coordinates for d5cmkb_.
(The format of our PDB-style files is described here.)

Timeline for d5cmkb_: