Lineage for d5bw0a_ (5bw0 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2185566Fold d.24: Pili subunits [54522] (1 superfamily)
    contains very long N-terminal helix, which end is packed against beta-sheet
  4. 2185567Superfamily d.24.1: Pili subunits [54523] (8 families) (S)
    bacterial filament proteins
  5. 2185670Family d.24.1.0: automated matches [233575] (1 protein)
    not a true family
  6. 2185671Protein automated matches [233576] (3 species)
    not a true protein
  7. 2185675Species Pseudomonas aeruginosa [TaxId:208964] [319670] (1 PDB entry)
  8. 2185676Domain d5bw0a_: 5bw0 A: [319671]
    automated match to d3njea_
    complexed with so4

Details for d5bw0a_

PDB Entry: 5bw0 (more details), 2 Å

PDB Description: the crystal structure of minor pseudopilin binary complex of xcpv and xcpw from the type 2 secretion system of pseudomonas aeruginosa
PDB Compounds: (A:) Type II secretion system protein J

SCOPe Domain Sequences for d5bw0a_:

Sequence, based on SEQRES records: (download)

>d5bw0a_ d.24.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
trvqeqrmrelvramgalerdltqaverpvrdelgdnrgaflsegendqiveftrggwrn
plgqarsrlqrvrwslsgetlerrywlvldraqdskprvqqvldgvtalswrfldkehnw
qghwptdegseeerleslplavemtlehrhygklvrvwrlldpp

Sequence, based on observed residues (ATOM records): (download)

>d5bw0a_ d.24.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
trvqeqrmrelvramgalerdltqaverpvrdelgdnrgaflsegndqiveftrggrlqr
vrwslsgetlerrywlvldraqdskprvqqvldgvtalswrfldkehnwqghwptdegee
erleslplavemtlehrhygklvrvwrlldpp

SCOPe Domain Coordinates for d5bw0a_:

Click to download the PDB-style file with coordinates for d5bw0a_.
(The format of our PDB-style files is described here.)

Timeline for d5bw0a_: