Lineage for d5jo5f1 (5jo5 F:2-106A)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2754877Domain d5jo5f1: 5jo5 F:2-106A [319668]
    Other proteins in same PDB: d5jo5a_, d5jo5b2, d5jo5c_, d5jo5d2, d5jo5e_, d5jo5f2, d5jo5h_, d5jo5l2
    automated match to d4m1dl1

Details for d5jo5f1

PDB Entry: 5jo5 (more details), 1.7 Å

PDB Description: crystal structure of 10e8 ghv-glv antigen-binding fragment.
PDB Compounds: (F:) 10E8 gLV

SCOPe Domain Sequences for d5jo5f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jo5f1 b.1.1.0 (F:2-106A) automated matches {Human (Homo sapiens) [TaxId: 9606]}
seltqdpavsvalgqtvritcqgdslrsyyaswyqqkpgqapvlviygknnrpsgipdrf
sgsssgntasltitgaqaedeadyycssrdksgsrlsvfgggtkltvl

SCOPe Domain Coordinates for d5jo5f1:

Click to download the PDB-style file with coordinates for d5jo5f1.
(The format of our PDB-style files is described here.)

Timeline for d5jo5f1: