SCOPe 2.08: Domain d5jnyd2: 5jny D:109-212

Lineage for d5jnyd2 (5jny D:109-212)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d5jnyd2: 5jny D:109-212 [319667]
   Other proteins in same PDB: d5jnya_, d5jnyb1, d5jnyc_, d5jnyd1
   automated match to d1lila2
   complexed with cl, ipa

Details for d5jnyd2

PDB Entry: 5jny, 3.04 Å

PDB Description: crystal structure of 10e8 fab

PDB Compounds: (D:) 10E8 Light Chain

SCOPe Domain Sequences for d5jnyd2:

Sequence; same for both SEQRES and ATOM records:

>d5jnyd2 b.1.1.2 (D:109-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvaptec

Timeline for d5jnyd2:

• d5jnyd2 first appeared in SCOPe 2.06
  
• d5jnyd2 appears in SCOPe 2.07