SCOPe 2.06: Domain d5bmvb2: 5bmv B:246-438

Lineage for d5bmvb2 (5bmv B:246-438)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein Tubulin beta-subunit [55313] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [64322] (11 PDB entries)
   Uniprot P02554

8. Domain d5bmvb2: 5bmv B:246-438 [319661]
   Other proteins in same PDB: d5bmva1, d5bmva2, d5bmvb1, d5bmvc1, d5bmvc2, d5bmvd1, d5bmve_, d5bmvf1, d5bmvf2, d5bmvf3
   automated match to d1sa0b2
   complexed with acp, ca, gdp, gol, gtp, mes, mg, vlb

Details for d5bmvb2

PDB Entry: 5bmv, 2.5 Å

PDB Description: crystal structure of tubulin-stathmin-ttl-vinblastine complex

PDB Compounds: (B:) Tubulin beta chain

SCOPe Domain Sequences for d5bmvb2:

Sequence, based on SEQRES records:

>d5bmvb2 d.79.2.1 (B:246-438) Tubulin beta-subunit {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdaknmmaac
dprhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqda

Sequence, based on observed residues (ATOM records):

>d5bmvb2 d.79.2.1 (B:246-438) Tubulin beta-subunit {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsrsqqyraltvpeltqqmfdaknmmaacd
prhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkms
atfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqq
yqda

Timeline for d5bmvb2:

• d5bmvb2 is new in SCOPe 2.06-stable
  
• d5bmvb2 appears in SCOPe 2.07
  
• d5bmvb2 appears in the current release, SCOPe 2.08