Lineage for d5bmvb1 (5bmv B:1-245)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2121563Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2121564Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2121565Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 2121663Protein Tubulin beta-subunit [52496] (2 species)
  7. 2121664Species Cow (Bos taurus) [TaxId:9913] [63990] (11 PDB entries)
    Uniprot P02550 ! Uniprot P02554
  8. 2121667Domain d5bmvb1: 5bmv B:1-245 [319660]
    Other proteins in same PDB: d5bmva1, d5bmva2, d5bmvb2, d5bmvc1, d5bmvc2, d5bmvd2, d5bmve_, d5bmvf1, d5bmvf2, d5bmvf3
    automated match to d1sa0b1
    complexed with acp, ca, gdp, gol, gtp, mes, mg, vlb

Details for d5bmvb1

PDB Entry: 5bmv (more details), 2.5 Å

PDB Description: crystal structure of tubulin-stathmin-ttl-vinblastine complex
PDB Compounds: (B:) Tubulin beta chain

SCOPe Domain Sequences for d5bmvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bmvb1 c.32.1.1 (B:1-245) Tubulin beta-subunit {Cow (Bos taurus) [TaxId: 9913]}
mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneaagnkyv
prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvv
epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl
rfp

SCOPe Domain Coordinates for d5bmvb1:

Click to download the PDB-style file with coordinates for d5bmvb1.
(The format of our PDB-style files is described here.)

Timeline for d5bmvb1: