![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
![]() | Family d.17.4.3: Ketosteroid isomerase-like [54434] (3 proteins) automatically mapped to Pfam PF12680 automatically mapped to Pfam PF02136 |
![]() | Protein automated matches [260878] (1 species) not a true protein |
![]() | Species Pseudomonas putida [TaxId:303] [260879] (3 PDB entries) |
![]() | Domain d5g2ga_: 5g2g A: [319657] automated match to d3rgra_ complexed with equ; mutant |
PDB Entry: 5g2g (more details), 1.6 Å
SCOPe Domain Sequences for d5g2ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5g2ga_ d.17.4.3 (A:) automated matches {Pseudomonas putida [TaxId: 303]} nlptaqevqglmaryielvdvgdieaivqmyaddatvedpfgqppihgreqiaafyrqgl gggkvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtkqayws evnlsvr
Timeline for d5g2ga_: