| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.167: Peptide deformylase [56419] (1 superfamily) alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix |
Superfamily d.167.1: Peptide deformylase [56420] (2 families) ![]() nickel-dependent enzyme |
| Family d.167.1.0: automated matches [191587] (1 protein) not a true family |
| Protein automated matches [191055] (16 species) not a true protein |
| Species Burkholderia xenovorans [TaxId:266265] [319599] (1 PDB entry) |
| Domain d5koba1: 5kob A:1-169 [319651] Other proteins in same PDB: d5koba2 automated match to d3dlda_ complexed with edo, fe2, fmt |
PDB Entry: 5kob (more details), 1.6 Å
SCOPe Domain Sequences for d5koba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5koba1 d.167.1.0 (A:1-169) automated matches {Burkholderia xenovorans [TaxId: 266265]}
mireilkmgdprllriadpvdhfdtpelhelvkdmfetmhdangaglaapqigvnlqvvi
fgfghnerypdappvpetvlinptitpvsqdmeegwegclsvpglrgavsrfsmikyhgf
dqygkpidrvaegfharvvqhecdhligklypmrindfakfgftevlfp
Timeline for d5koba1: