Lineage for d5koba1 (5kob A:1-169)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2234288Fold d.167: Peptide deformylase [56419] (1 superfamily)
    alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix
  4. 2234289Superfamily d.167.1: Peptide deformylase [56420] (2 families) (S)
    nickel-dependent enzyme
  5. 2234455Family d.167.1.0: automated matches [191587] (1 protein)
    not a true family
  6. 2234456Protein automated matches [191055] (16 species)
    not a true protein
  7. 2234468Species Burkholderia xenovorans [TaxId:266265] [319599] (1 PDB entry)
  8. 2234469Domain d5koba1: 5kob A:1-169 [319651]
    Other proteins in same PDB: d5koba2
    automated match to d3dlda_
    complexed with edo, fe2, fmt

Details for d5koba1

PDB Entry: 5kob (more details), 1.6 Å

PDB Description: crystal structure of a peptide deformylase from burkholderia xenovorans
PDB Compounds: (A:) Peptide deformylase

SCOPe Domain Sequences for d5koba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5koba1 d.167.1.0 (A:1-169) automated matches {Burkholderia xenovorans [TaxId: 266265]}
mireilkmgdprllriadpvdhfdtpelhelvkdmfetmhdangaglaapqigvnlqvvi
fgfghnerypdappvpetvlinptitpvsqdmeegwegclsvpglrgavsrfsmikyhgf
dqygkpidrvaegfharvvqhecdhligklypmrindfakfgftevlfp

SCOPe Domain Coordinates for d5koba1:

Click to download the PDB-style file with coordinates for d5koba1.
(The format of our PDB-style files is described here.)

Timeline for d5koba1: