SCOPe 2.08: Domain d5koba1: 5kob A:1-169

Lineage for d5koba1 (5kob A:1-169)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.167: Peptide deformylase [56419] (1 superfamily)
   alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix

4. Superfamily d.167.1: Peptide deformylase [56420] (2 families)
   nickel-dependent enzyme

5. Family d.167.1.0: automated matches [191587] (1 protein)
   not a true family

6. Protein automated matches [191055] (20 species)
   not a true protein

7. Species Burkholderia xenovorans [TaxId:266265] [319599] (1 PDB entry)

8. Domain d5koba1: 5kob A:1-169 [319651]
   Other proteins in same PDB: d5koba2
   automated match to d3dlda_
   complexed with edo, fe2, fmt

Details for d5koba1

PDB Entry: 5kob, 1.6 Å

PDB Description: crystal structure of a peptide deformylase from burkholderia xenovorans

PDB Compounds: (A:) Peptide deformylase

SCOPe Domain Sequences for d5koba1:

Sequence; same for both SEQRES and ATOM records:

>d5koba1 d.167.1.0 (A:1-169) automated matches {Burkholderia xenovorans [TaxId: 266265]}
mireilkmgdprllriadpvdhfdtpelhelvkdmfetmhdangaglaapqigvnlqvvi
fgfghnerypdappvpetvlinptitpvsqdmeegwegclsvpglrgavsrfsmikyhgf
dqygkpidrvaegfharvvqhecdhligklypmrindfakfgftevlfp

Timeline for d5koba1:

• d5koba1 first appeared in SCOPe 2.06
  
• d5koba1 appears in SCOPe 2.07