Lineage for d5kbyd2 (5kby D:509-766)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2474355Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2474356Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2476490Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2476491Protein automated matches [190543] (108 species)
    not a true protein
  7. 2476710Species Human (Homo sapiens) [TaxId:9606] [188340] (89 PDB entries)
  8. 2476775Domain d5kbyd2: 5kby D:509-766 [319650]
    Other proteins in same PDB: d5kbya1, d5kbyb1, d5kbyb3, d5kbyc1, d5kbyd1
    automated match to d1orva2
    complexed with 6rl, nag

Details for d5kbyd2

PDB Entry: 5kby (more details), 2.24 Å

PDB Description: crystal structure of dipeptidyl peptidase iv in complex with syr-472
PDB Compounds: (D:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d5kbyd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kbyd2 c.69.1.0 (D:509-766) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah
qhiythmshfikqcfslp

SCOPe Domain Coordinates for d5kbyd2:

Click to download the PDB-style file with coordinates for d5kbyd2.
(The format of our PDB-style files is described here.)

Timeline for d5kbyd2: