Class c: Alpha and beta proteins (a/b) [51349] (107 folds) |
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) |
Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families) |
Family c.37.1.8: G proteins [52592] (20 proteins) |
Protein cH-p21 Ras protein [52593] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [52594] (34 PDB entries) |
Domain d1ctqa_: 1ctq A: [31965] |
PDB Entry: 1ctq (more details), 1.26 Å
SCOP Domain Sequences for d1ctqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens)} mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh
Timeline for d1ctqa_: