![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.167: Peptide deformylase [56419] (1 superfamily) alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix |
![]() | Superfamily d.167.1: Peptide deformylase [56420] (2 families) ![]() nickel-dependent enzyme |
![]() | Family d.167.1.0: automated matches [191587] (1 protein) not a true family |
![]() | Protein automated matches [191055] (20 species) not a true protein |
![]() | Species Burkholderia xenovorans [TaxId:266265] [319599] (1 PDB entry) |
![]() | Domain d5kobd_: 5kob D: [319640] Other proteins in same PDB: d5koba2 automated match to d3dlda_ complexed with edo, fe2, fmt |
PDB Entry: 5kob (more details), 1.6 Å
SCOPe Domain Sequences for d5kobd_:
Sequence, based on SEQRES records: (download)
>d5kobd_ d.167.1.0 (D:) automated matches {Burkholderia xenovorans [TaxId: 266265]} ireilkmgdprllriadpvdhfdtpelhelvkdmfetmhdangaglaapqigvnlqvvif gfghnerypdappvpetvlinptitpvsqdmeegwegclsvpglrgavsrfsmikyhgfd qygkpidrvaegfharvvqhecdhligklypmrindfakfgftevlfp
>d5kobd_ d.167.1.0 (D:) automated matches {Burkholderia xenovorans [TaxId: 266265]} ireilkmgdprllriadpvdhfdtpelhelvkdmfetmhdangaglaapqigvnlqvvif gfvpetvlinptitpvsqdmeegwegclsvpglrgavsrfsmikyhgfdqygkpidrvae gfharvvqhecdhligklypmrindfakfgftevlfp
Timeline for d5kobd_:
![]() Domains from other chains: (mouse over for more information) d5koba1, d5koba2, d5kobb_, d5kobc_ |