SCOPe 2.06: Domain d5kcjb_: 5kcj B:

Lineage for d5kcjb_ (5kcj B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)

6. Protein N-methyl-D-aspartate receptor subunit 1 [89787] (3 species)

7. Species Homo sapiens [TaxId:9606] [314718] (12 PDB entries)

8. Domain d5kcjb_: 5kcj B: [319626]
   Other proteins in same PDB: d5kcja_
   automated match to d5i2kb_
   complexed with 6rm, act, glu, gly

Details for d5kcjb_

PDB Entry: 5kcj, 2.09 Å

PDB Description: structure of the human glun1/glun2a lbd in complex with gne6901

PDB Compounds: (B:) Glutamate receptor ionotropic, NMDA 1

SCOPe Domain Sequences for d5kcjb_:

Sequence, based on SEQRES records:

>d5kcjb_ c.94.1.1 (B:) N-methyl-D-aspartate receptor subunit 1 {Homo sapiens [TaxId: 9606]}
trlkivtihqepfvyvkptlsdgtckeeftvngdpvkkvictgpndtspgsprhtvpqcc
ygfcidlliklartmnftyevhlvadgkfgtqervnnsnkkewngmmgellsgqadmiva
pltinneraqyiefskpfkyqgltilvkkgtritgindprlrnpsdkfiyatvkqssvdi
yfrrqvelstmyrhmekhnyesaaeaiqavrdnklhafiwdsavlefeasqkcdlvttge
lffrsgfgigmrkdspwkqnvslsilkshengfmedldktwvr

Sequence, based on observed residues (ATOM records):

>d5kcjb_ c.94.1.1 (B:) N-methyl-D-aspartate receptor subunit 1 {Homo sapiens [TaxId: 9606]}
trlkivtihqepfvyvkptlsdgtckeeftvngdpvkkvictgpndtspgsprhtvpqcc
ygfcidlliklartmnftyevhlvadgkfgtqervnkkewngmmgellsgqadmivaplt
inneraqyiefskpfkyqgltilvkkgtritgindprlrnpsdkfiyatvkqssvdiyfr
rqvelstmyrhmekhnyesaaeaiqavrdnklhafiwdsavlefeasqkcdlvttgelff
rsgfgigmrkdspwkqnvslsilkshengfmedldktwvr

Timeline for d5kcjb_:

• d5kcjb_ is new in SCOPe 2.06-stable
  
• d5kcjb_ appears in SCOPe 2.07
  
• d5kcjb_ appears in the current release, SCOPe 2.08