Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) |
Protein N-methyl-D-aspartate receptor subunit 1 [89787] (3 species) |
Species Homo sapiens [TaxId:9606] [314718] (12 PDB entries) |
Domain d5kcjb_: 5kcj B: [319626] Other proteins in same PDB: d5kcja_ automated match to d5i2kb_ complexed with 6rm, act, glu, gly |
PDB Entry: 5kcj (more details), 2.09 Å
SCOPe Domain Sequences for d5kcjb_:
Sequence, based on SEQRES records: (download)
>d5kcjb_ c.94.1.1 (B:) N-methyl-D-aspartate receptor subunit 1 {Homo sapiens [TaxId: 9606]} trlkivtihqepfvyvkptlsdgtckeeftvngdpvkkvictgpndtspgsprhtvpqcc ygfcidlliklartmnftyevhlvadgkfgtqervnnsnkkewngmmgellsgqadmiva pltinneraqyiefskpfkyqgltilvkkgtritgindprlrnpsdkfiyatvkqssvdi yfrrqvelstmyrhmekhnyesaaeaiqavrdnklhafiwdsavlefeasqkcdlvttge lffrsgfgigmrkdspwkqnvslsilkshengfmedldktwvr
>d5kcjb_ c.94.1.1 (B:) N-methyl-D-aspartate receptor subunit 1 {Homo sapiens [TaxId: 9606]} trlkivtihqepfvyvkptlsdgtckeeftvngdpvkkvictgpndtspgsprhtvpqcc ygfcidlliklartmnftyevhlvadgkfgtqervnkkewngmmgellsgqadmivaplt inneraqyiefskpfkyqgltilvkkgtritgindprlrnpsdkfiyatvkqssvdiyfr rqvelstmyrhmekhnyesaaeaiqavrdnklhafiwdsavlefeasqkcdlvttgelff rsgfgigmrkdspwkqnvslsilkshengfmedldktwvr
Timeline for d5kcjb_: