Lineage for d3bifa1 (3bif A:37-249)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 179162Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 179163Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) (S)
  5. 179422Family c.37.1.7: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain [52589] (1 protein)
  6. 179423Protein 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain [52590] (1 species)
  7. 179424Species Rat (Rattus norvegicus) [TaxId:10116] [52591] (3 PDB entries)
  8. 179426Domain d3bifa1: 3bif A:37-249 [31962]
    Other proteins in same PDB: d3bifa2

Details for d3bifa1

PDB Entry: 3bif (more details), 2.3 Å

PDB Description: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase empty 6-pf-2k active site

SCOP Domain Sequences for d3bifa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus)}
cptlivmvglpargktyiskkltrylnfigvptrefnvgqyrrdmvktyksfefflpdne
eglkirkqcalaalndvrkflseegghvavfdatnttrerramifnfgeqngyktffves
icvdpeviaanivqvklgspdyvnrdsdeatedfmrriecyensyesldeeqdrdlsyik
imdvgqsyvvnrvadhiqsrivyylmnihvtpr

SCOP Domain Coordinates for d3bifa1:

Click to download the PDB-style file with coordinates for d3bifa1.
(The format of our PDB-style files is described here.)

Timeline for d3bifa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3bifa2