SCOPe 2.08: Domain d5jo5b2: 5jo5 B:107-210

Lineage for d5jo5b2 (5jo5 B:107-210)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d5jo5b2: 5jo5 B:107-210 [319619]
   Other proteins in same PDB: d5jo5a_, d5jo5b1, d5jo5c_, d5jo5d1, d5jo5e_, d5jo5f1, d5jo5h_, d5jo5l1
   automated match to d5azel2

Details for d5jo5b2

PDB Entry: 5jo5, 1.7 Å

PDB Description: crystal structure of 10e8 ghv-glv antigen-binding fragment.

PDB Compounds: (B:) 10E8 gLV

SCOPe Domain Sequences for d5jo5b2:

Sequence; same for both SEQRES and ATOM records:

>d5jo5b2 b.1.1.2 (B:107-210) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sqpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpsk
qsnnkyaassylsltpeqwkshrsyscqvthegstvektvapte

Timeline for d5jo5b2:

• d5jo5b2 first appeared in SCOPe 2.06
  
• d5jo5b2 appears in SCOPe 2.07