Class b: All beta proteins [48724] (177 folds) |
Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
Superfamily b.69.15: Retinal pigment epithelial membrane protein-like [310595] (1 family) Pfam PF03055 |
Family b.69.15.1: RPE65-like [310643] (2 proteins) |
Protein automated matches [310886] (2 species) not a true protein |
Species Synechocystis sp. [TaxId:1111708] [311494] (5 PDB entries) |
Domain d5kk0b_: 5kk0 B: [319611] automated match to d5e47b_ complexed with cl, fe2; mutant |
PDB Entry: 5kk0 (more details), 2.8 Å
SCOPe Domain Sequences for d5kk0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5kk0b_ b.69.15.1 (B:) automated matches {Synechocystis sp. [TaxId: 1111708]} psqrsyspqdwlrgyqsqpqewdywvedvegsippdlqgtlyrngpglleigdrplkhpf dgdgmvtafkfpgdgrvhfqskfvrtqgyveeqkagkmiyrgvfgsqpaggwlktifdlr lkniananitywgdrllalweggqphrlepsnlatiglddlggilaegqplsahpridpa stfdggqpcyvtfsiksslsstltlleldpqgkllrqktetfpgfafihdfaitphyaif lqnnvtlnglpylfglrgagecvqfhpdkpaqiilvprdggeikripvqagfvfhhanaf eengkiildsicynslpqvdtdgdfrstnfdnldpgqlwrftidpaaatvekqlmvsrcc efpvvhpqqvgrpyryvymgaahhstgnaplqailkvdlesgtetlrsfaphgfagepif vprpggvaeddgwllcliykadlhrselvildaqditapaiatlklkhhipyplhgswaq t
Timeline for d5kk0b_: